PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv5_113480_aoik.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 244aa    MW: 27908.7 Da    PI: 9.6041
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv5_113480_aoik.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.11.3e-29959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krienk+nrqvtfskRr g+lKKA+E+S+LCda+va+iifs++gkl+ey+s
  Bv5_113480_aoik.t1  9 KRIENKINRQVTFSKRRIGLLKKAHEISILCDADVALIIFSTKGKLFEYAS 59
                        79***********************************************86 PP

2K-box99.83.9e-338717413100
               K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                          + sl+ e+akLk++++ Lq++qRh++Ge+L++LslkeLq+Le+q++++lk+iRskKn+l++e+i++lq+k k+l+e+n+ L+kk++e
  Bv5_113480_aoik.t1  87 SHVSLTLEHAKLKARLDILQKNQRHYMGEELDTLSLKELQNLEHQIDSALKHIRSKKNQLMHESISQLQRKDKALKEHNNLLSKKVKE 174
                         5678899******************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.637161IPR002100Transcription factor, MADS-box
SMARTSM004329.2E-39160IPR002100Transcription factor, MADS-box
CDDcd002651.02E-40279No hitNo description
SuperFamilySSF554551.7E-32285IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.3E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-303859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129716.14688178IPR002487Transcription factor, K-box
PfamPF014862.9E-2790172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010154Biological Processfruit development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRIGLLK KAHEISILCD ADVALIIFST KGKLFEYASD  60
TCMERILERY ERHSYAERQL TAPDPGSHVS LTLEHAKLKA RLDILQKNQR HYMGEELDTL  120
SLKELQNLEH QIDSALKHIR SKKNQLMHES ISQLQRKDKA LKEHNNLLSK KVKEREKVLA  180
QQAELDQQNH DNNSSGFVMS QALPSLNTGG TSSSAVEDEA TQPPNLNSNS AQIPSWMLQH  240
IQEQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q1e-22174173Myocyte-specific enhancer factor 2B
1tqe_R1e-22174173Myocyte-specific enhancer factor 2B
1tqe_S1e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678364.10.0PREDICTED: truncated transcription factor CAULIFLOWER A
SwissprotQ424291e-116AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLA0A0J8CFD50.0A0A0J8CFD5_BETVU; Uncharacterized protein
STRINGSolyc03g114830.2.11e-115(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.14e-98AGAMOUS-like 8